PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_025262-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 222aa    MW: 25409.9 Da    PI: 7.816
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_025262-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.22.9e-32148206159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+H+h+
  NNU_025262-RA 148 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHTHS 206
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.2E-34133206IPR003657WRKY domain
SuperFamilySSF1182901.57E-28140206IPR003657WRKY domain
PROSITE profilePS5081128.897143205IPR003657WRKY domain
SMARTSM007747.5E-38148207IPR003657WRKY domain
PfamPF031063.4E-25149205IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MDGDRGASRS CYELEAPFSS AQPVHEMGFV QFEESQGLSF LLPCQPSHHH HHHQLSLPIN  60
NSSSSNSKTT VGLSGDDVAT RPTPWNNDQV GRLEPKTTVN DENSSGIAND DNSSWWRNSS  120
SDKSKVKVRR KLREPRFCFQ TRSDVDVLDD GYKWRKYGQK VVKNSLHPRS YYRCTHNNCR  180
VKKRVERLSE DCRMVITTYE GRHTHSPCDD SNSSEHECFS SF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-25139205874Probable WRKY transcription factor 4
2lex_A2e-25139205874Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126132KVRRKLR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010246101.11e-167PREDICTED: probable WRKY transcription factor 12 isoform X1
SwissprotQ93WY48e-70WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A061DUM51e-106A0A061DUM5_THECC; WRKY family transcription factor
STRINGGLYMA07G13611.15e-95(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.13e-57WRKY family protein